Structure of PDB 4v7l Chain DN

Receptor sequence

>4v7lDN (length=138) Species: 300852 (Thermus thermophilus HB8)

MKTYVPKQVEPRWVLIDAEGKTLGRLATKIATLLRGKHRPDWTPNVAMGD
FVVVVNADKIRVTGKKLEQKIYTRYSGYPGGLKKIPLEKMLATHPERVLE
HAVKGMLPKGPLGRRLFKRLKVYAGPDHPHQAQRPEKL

3D structure

• PDB: 4v7l The structures of the anti-tuberculosis antibiotics viomycin and capreomycin bound to the 70S ribosome.
• Chain: DN
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	DN	Y4 L23 G24 R25 T28 T32 R35 K37 P44 N45 F51 T63 K65 K66 Q69 K70 R74 Y75 S76 P79 G80 L82 K83 H94 R97 H101 A102 G105 M106 L107 K109 G110 P111 R114 R115 K118 K121 P129 H130	Y4 L23 G24 R25 T28 T32 R35 K37 P44 N45 F51 T63 K65 K66 Q69 K70 R74 Y75 S76 P79 G80 L82 K83 H94 R97 H101 A102 G105 M106 L107 K109 G110 P111 R114 R115 K118 K121 P129 H130

Gene Ontology

Molecular Function

• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation
• GO:0017148 negative regulation of translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v7l, PDBe:4v7l, PDBj:4v7l
• PDBsum: 4v7l
• PubMed: 20154709
• UniProt: P60488|RL13_THET8 Large ribosomal subunit protein uL13 (Gene Name=rplM)