Structure of PDB 4wqu Chain DM

Receptor sequence

>4wquDM (length=116) Species: 300852 (Thermus thermophilus HB8)

RIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAE
VVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQR
TRTNARTRKGPRKTVA

3D structure

• PDB: 4wqu Conformational Changes of Elongation Factor G on the Ribosome during tRNA Translocation.
• Chain: DM
• Resolution: 2.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	DM	R14 Y21 Y23 G24 I25 G26 R29 R44 N77 Y87 R88 L96 P97 V98 R99 Q101 R102 T103 R104 T105 N106 A107 R108 T109 R110 K111 P113 R114 K115 T116	R12 Y19 Y21 G22 I23 G24 R27 R42 N75 Y85 R86 L94 P95 V96 R97 Q99 R100 T101 R102 T103 N104 A105 R106 T107 R108 K109 P111 R112 K113 T114

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4wqu, PDBe:4wqu, PDBj:4wqu
• PDBsum: 4wqu
• PubMed: 25594181
• UniProt: P80377|RS13_THET8 Small ribosomal subunit protein uS13 (Gene Name=rpsM)