Structure of PDB 8oeq Chain DL

Receptor sequence

>8oeqDL (length=132) Species: 5476 (Candida albicans)

DAVTIRTRKVISNPLLARRQFVIDVLHPNRANVSKDELREKLAEIYKAEK
DAVSVFGFRTQFGGGKSTGFGLIYQSVADAKRFEPAYRLVRYGLAEKVEK
ASRQQRKQKKNRDKKIFGTQRRAQKRAARRNA

3D structure

• PDB: 8oeq Drug-induced rotational movement of the ribosome is a key factor for read-through enhancement
• Chain: DL
• Resolution: 3.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	DL	R8 T9 R10 K11 V12 R21 A33 N34 S36 K37 Y48 F58 G59 F60 R61 T62 F64 G66 Y89 R93 R105 Q106 K109 K112 N113 K116 K117 F119 G120 T121 R123 R124 K127 R128 R132	R6 T7 R8 K9 V10 R19 A31 N32 S34 K35 Y46 F56 G57 F58 R59 T60 F62 G64 Y87 R91 R103 Q104 K107 K110 N111 K114 K115 F117 G118 T119 R121 R122 K125 R126 R130

External links

• PDB: RCSB:8oeq, PDBe:8oeq, PDBj:8oeq
• PDBsum: 8oeq
• UniProt: A0A8H6C3K1