Structure of PDB 7aju Chain DL

Receptor sequence

>7ajuDL (length=140) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

TVQSERAFQKQPHIFNNPKVKTSKRTKRWYKNAGLGFKTPKTAIEGSYID
KKCPFTGLVSIRGKILTGTVVSTKMHRTIVIRRAYLHYIPKYNRYEKRHK
NVPVHVSPAFRVQVGDIVTVGQCRPISKTVRFNVVKVSAA

3D structure

PDB

7aju Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.

Chain

Resolution

3.8 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	DL	E10 A12 P17 H18 F20 W34 N37 G39 L40 K43 K46 K56 K57 L63 S65 I66 R67 K69 S77 K79 M80 H81 Y90 H92 K96 Y97 K102 R103 H104 K105 N106 R116 R129 P130 I131 S132 K133 T134 R136 F137	E5 A7 P12 H13 F15 W29 N32 G34 L35 K38 K41 K51 K52 L58 S60 I61 R62 K64 S72 K74 M75 H76 Y85 H87 K91 Y92 K97 R98 H99 K100 N101 R111 R124 P125 I126 S127 K128 T129 R131 F132

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0000462	maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:0030686	90S preribosome
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:7aju, PDBe:7aju, PDBj:7aju
PDBsum	7aju
PubMed	33326748
UniProt	P0CX47\|RS11A_YEAST Small ribosomal subunit protein uS17A (Gene Name=RPS11A)