Structure of PDB 4wt8 Chain DL

Receptor sequence
>4wt8DL (length=59) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
MPRLKVKLVKSPIGYPKDQKAALKALGLRRLQQERVLEDTPAIRGNVEKV
AHLVRVEVV
3D structure
PDB4wt8 Bactobolin A Binds to a Site on the 70S Ribosome Distinct from Previously Seen Antibiotics.
ChainDL
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna DL K10 S11 I13 G14 P16 K17 A21 A22 K24 A25 R29 R30 L31 Q32 P41 A42 G45 N46 K49 K10 S11 I13 G14 P16 K17 A21 A22 K24 A25 R29 R30 L31 Q32 P41 A42 G45 N46 K49
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4wt8, PDBe:4wt8, PDBj:4wt8
PDBsum4wt8
PubMed25562208
UniProtQ5SHQ6|RL30_THET8 Large ribosomal subunit protein uL30 (Gene Name=rpmD)

[Back to BioLiP]