Structure of PDB 4v8p Chain DL

Receptor sequence

>4v8pDL (length=108) Species: 5911 (Tetrahymena thermophila)

AQRITYRRRCSYNTRSNKVRKVKTPGGRLVAQYVKKVVNYTKCSEAGCNV
ALNGIAQVRPAEYATIARSAKTVSRVYGGELCHTCVRSRIIRAFLTEEVK
IVKRKMIS

3D structure

• PDB: 4v8p Crystal Structure of the Eukaryotic 60S Ribosomal Subunit in Complex with Initiation Factor 6.
• Chain: DL
• Resolution: 3.52 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	DL	A2 R4 I5 T6 Y7 R8 R9 R10 C11 S12 Y13 N14 T15 R16 S17 K19 R21 K22 V23 K24 T25 P26 G27 R29 L30 Q33 V35 K36 K37 V38 V39 N40 S45 A47 G48 N54 G55 I56 Q58 P61 A62 Y64 A65 T66 R69 K72 S75 R76 V77 Y78 E81 H84 R90 R93	A1 R3 I4 T5 Y6 R7 R8 R9 C10 S11 Y12 N13 T14 R15 S16 K18 R20 K21 V22 K23 T24 P25 G26 R28 L29 Q32 V34 K35 K36 V37 V38 N39 S44 A46 G47 N53 G54 I55 Q57 P60 A61 Y63 A64 T65 R68 K71 S74 R75 V76 Y77 E80 H83 R89 R92
BS02	ZN	DL	C44 C49 C83 C86	C43 C48 C82 C85

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v8p, PDBe:4v8p, PDBj:4v8p
• PDBsum: 4v8p
• PubMed: 22052974
• UniProt: P0DJ23|RL34_TETTS Large ribosomal subunit protein eL34 (Gene Name=RPL34)