Structure of PDB 4v6f Chain DL

Receptor sequence
>4v6fDL (length=145) Species: 274 (Thermus thermophilus) [Search protein sequence]
KVVAVVKLQLPAGKATPAPPVGPALGQHGANIMEFVKAFNAATANMGDAI
VPVEITIYADRSFTFVTKTPPASYLIRKAAGLEKGAHKPGREKVGRITWE
QVLEIAKQKMPDLNTTDLEAAARMIAGSARSMGVEVVGAPEVKDA
3D structure
PDB4v6f Structural aspects of messenger RNA reading frame maintenance by the ribosome.
ChainDL
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna DL V4 V5 K9 I52 V53 P54 T71 P73 A74 S75 A88 H89 R93 L115 N116 T117 A122 R125 M126 I127 G129 S130 S133 M134 V2 V3 K7 I50 V51 P52 T69 P71 A72 S73 A86 H87 R91 L113 N114 T115 A120 R123 M124 I125 G127 S128 S131 M132
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v6f, PDBe:4v6f, PDBj:4v6f
PDBsum4v6f
PubMed20400952
UniProtQ5SLP6|RL11_THET8 Large ribosomal subunit protein uL11 (Gene Name=rplK)

[Back to BioLiP]