Structure of PDB 7ajt Chain DJ

Receptor sequence

>7ajtDJ (length=185) Species: 559292 (Saccharomyces cerevisiae S288C)

PRAPRTYSKTYSTPKRPYESSRLDAELKLAGEFGLKNKKEIYRISFQLSK
IRRAARDLLTRDEKDPKRLFEGNALIRRLVRVGVLSEDKKKLDYVLALKV
EDFLERRLQTQVYKLGLAKSVHHARVLITQRHIAVGKQIVNIPSFMVRLD
SEKHIDFAPTSPFGGARPGRVARRNAARKAEASGE

3D structure

• PDB: 7ajt Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
• Chain: DJ
• Resolution: 4.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	DJ	P2 R3 A4 P5 R6 S9 T11 K37 N38 R44 F71 K120 S121 H124 R126 T130 Q131 H133 Q139 I143 S145 F146 R149 S152 P163 F164 G170 R171 V172 A173 R175 N176	P1 R2 A3 P4 R5 S8 T10 K36 N37 R43 F70 K119 S120 H123 R125 T129 Q130 H132 Q138 I142 S144 F145 R148 S151 P162 F163 G169 R170 V171 A172 R174 N175

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding
• GO:0019843 rRNA binding

Biological Process

• GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0006364 rRNA processing
• GO:0006412 translation
• GO:0042254 ribosome biogenesis
• GO:0042274 ribosomal small subunit biogenesis

Cellular Component

• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:0022627 cytosolic small ribosomal subunit
• GO:0030686 90S preribosome
• GO:0032040 small-subunit processome
• GO:0043226 organelle
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7ajt, PDBe:7ajt, PDBj:7ajt
• PDBsum: 7ajt
• PubMed: 33326748
• UniProt: O13516|RS9A_YEAST Small ribosomal subunit protein uS4A (Gene Name=RPS9A)