Structure of PDB 4ym7 Chain DJ

Receptor sequence

>4ym7DJ (length=69) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMI
LTHVDLIEKFLRYNPLEKR

3D structure

PDB

4ym7 An alternative RNA polymerase I structure reveals a dimer hinge.

Chain

Resolution

5.5 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	DJ	C7 C45 C46	C7 C45 C46

Gene Ontology

	Molecular Function
GO:0001054	RNA polymerase I activity
GO:0001055	RNA polymerase II activity
GO:0001056	RNA polymerase III activity
GO:0003677	DNA binding
GO:0003899	DNA-directed 5'-3' RNA polymerase activity
GO:0003968	RNA-dependent RNA polymerase activity
GO:0005515	protein binding
GO:0008270	zinc ion binding
GO:0046872	metal ion binding

	Biological Process
GO:0001172	RNA-templated transcription
GO:0006351	DNA-templated transcription
GO:0006360	transcription by RNA polymerase I
GO:0006361	transcription initiation at RNA polymerase I promoter
GO:0006362	transcription elongation by RNA polymerase I
GO:0006363	termination of RNA polymerase I transcription
GO:0006366	transcription by RNA polymerase II
GO:0006367	transcription initiation at RNA polymerase II promoter
GO:0006368	transcription elongation by RNA polymerase II
GO:0006383	transcription by RNA polymerase III
GO:0006384	transcription initiation at RNA polymerase III promoter
GO:0006386	termination of RNA polymerase III transcription
GO:0042254	ribosome biogenesis
GO:0042790	nucleolar large rRNA transcription by RNA polymerase I
GO:0042797	tRNA transcription by RNA polymerase III

	Cellular Component
GO:0000428	DNA-directed RNA polymerase complex
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005665	RNA polymerase II, core complex
GO:0005666	RNA polymerase III complex
GO:0005730	nucleolus
GO:0005736	RNA polymerase I complex

External links

PDB	RCSB:4ym7, PDBe:4ym7, PDBj:4ym7
PDBsum	4ym7
PubMed	26327374
UniProt	P22139\|RPAB5_YEAST DNA-directed RNA polymerases I, II, and III subunit RPABC5 (Gene Name=RPB10)