Structure of PDB 4v5b Chain DJ

Receptor sequence
>4v5bDJ (length=98) Species: 199310 (Escherichia coli CFT073) [Search protein sequence]
RIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRKERFTVLIS
PHVNKDARDQYEIRTHLRLVDIVEPTEKTVDALMRLDLAAGVDVQISL
3D structure
PDB4v5b A Peptide Deformylase-Ribosome Complex Reveals Mechanism of Nascent Chain Processing.
ChainDJ
Resolution3.74 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna DJ R9 K11 H15 D19 R37 P39 I40 P41 L42 P43 R45 E47 T50 I53 S54 P55 H56 V57 N58 D63 H70 R72 Q99 R5 K7 H11 D15 R33 P35 I36 P37 L38 P39 R41 E43 T46 I49 S50 P51 H52 V53 N54 D59 H66 R68 Q95
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0001072 transcription antitermination factor activity, RNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0031564 transcription antitermination
GO:0032784 regulation of DNA-templated transcription elongation
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0008023 transcription elongation factor complex
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v5b, PDBe:4v5b, PDBj:4v5b
PDBsum4v5b
PubMed18288106
UniProtP0A7R6|RS10_ECOL6 Small ribosomal subunit protein uS10 (Gene Name=rpsJ)

[Back to BioLiP]