Structure of PDB 8oeq Chain DI |
>8oeqDI (length=87) Species: 5476 (Candida albicans) [Search protein sequence] |
MENDKGQLVELYVPRKCSATNRIIKAKDHASVQISIAKVDEDGRAIAGEN ITYALSGYVRGRGEADDSLNRLAQQDGLLKNVWSYSR |
|
PDB | 8oeq Drug-induced rotational movement of the ribosome is a key factor for read-through enhancement |
Chain | DI |
Resolution | 3.3 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
DI |
Y58 R62 |
Y58 R62 |
|
|
|