Structure of PDB 6zqg Chain DI

Receptor sequence

>6zqgDI (length=188) Species: 559292 (Saccharomyces cerevisiae S288C)

GISRDSRHKRSATGAKRAQFRKKRKFELGRQPANTKIGAKRIHSVRTRGG
NKKYRALRIETGNFSWASEGISKKTRIAGVVYHPSNNELVRTNTLTKAAI
VQIDATPFRQWFEAHYGQTLGKKSKNAERKWAARAASAKIESSVESQFSA
GRLYACISSRPGQSGRCDGYILEGEELAFYLRRLTAKK

3D structure

• PDB: 6zqg 90 S pre-ribosome transformation into the primordial 40 S subunit.
• Chain: DI
• Resolution: 3.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	DI	R5 R8 K10 R11 T14 R18 R22 K23 K24 R25 K26 F27 G30 R31 P33 K41 R42 I43 R47 T48 R49 G50 K54 R56 N64 S66 A68 S73 S86 T97 K98 K137 N138 R141 S170 S171 R172 Q175 R178 D180	R4 R7 K9 R10 T13 R17 R21 K22 K23 R24 K25 F26 G29 R30 P32 K40 R41 I42 R46 T47 R48 G49 K53 R55 N63 S65 A67 S72 S85 T96 K97 K125 N126 R129 S158 S159 R160 Q163 R166 D168

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:0030686 90S preribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6zqg, PDBe:6zqg, PDBj:6zqg
• PDBsum: 6zqg
• PubMed: 32943521
• UniProt: P0CX39|RS8A_YEAST Small ribosomal subunit protein eS8A (Gene Name=RPS8A)