Structure of PDB 4v9n Chain DI

Receptor sequence
>4v9nDI (length=145) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]
MKVILLEPLENLGDVGQVVDVKPGYARNYLLPRGLAVLATESNLKALEAR
IRAQAKRLAERKAEAERLKEILENLTLTIPVRAGETKIYGSVTAKDIAEA
LSRQHGITIDPKRLALEKPIKELGEYVLTYKPHPEVPIQLKVSVV
3D structure
PDB4v9n Crystal Structure of the 70S Ribosome Bound with the Q253P Mutant Form of Release Factor RF2.
ChainDI
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna DI K87 Y89 G90 K121 K87 Y89 G90 K121
BS02 rna DI K22 P23 G24 Y25 N28 Y29 R33 S42 K45 A49 R50 K22 P23 G24 Y25 N28 Y29 R33 S42 K45 A49 R50
BS03 MG DI G84 Y89 G84 Y89
BS04 MG DI I88 Y89 I88 Y89
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v9n, PDBe:4v9n, PDBj:4v9n
PDBsum4v9n
PubMed23769667
UniProtQ72GV5|RL9_THET2 Large ribosomal subunit protein bL9 (Gene Name=rplI)

[Back to BioLiP]