Structure of PDB 4v6d Chain DI |
>4v6dDI (length=141) Species: 83333 (Escherichia coli K-12) [Search protein sequence] |
AKKVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAKTDSIEK GLPIPVVITVYADRSFTFVTKTPPAAVLLKKAAGIKSGSGKPNKDKVGKI SRAQLQEIAQTKAADMTGADIEAMTRSIEGTARSMGLVVED |
|
PDB | 4v6d Structures of the ribosome in intermediate States of ratcheting. |
Chain | DI |
Resolution | 3.814 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
DI |
A6 Y7 K9 K71 P92 |
A6 Y7 K9 K71 P92 |
|
|
|
|