Structure of PDB 4v5e Chain DI

Receptor sequence
>4v5eDI (length=145) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
MKVILLEPLENLGDVGQVVDVKPGYARNYLLPRGLAVLATESNLKALEAR
IRAQAKRLAERKAEAERLKEILENLTLTIPVRAGETKIYGSVTAKDIAEA
LSRQHGITIDPKRLALEKPIKELGEYVLTYKPHPEVPIQLKVSVV
3D structure
PDB4v5e Insights Into Translational Termination from the Structure of Rf2 Bound to the Ribosome.
ChainDI
Resolution3.45 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna DI P8 R82 K87 Y89 G90 S91 K121 P8 R82 K87 Y89 G90 S91 K121
BS02 rna DI K22 P23 G24 R27 N28 R33 S42 A46 R50 R57 K22 P23 G24 R27 N28 R33 S42 A46 R50 R57
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v5e, PDBe:4v5e, PDBj:4v5e
PDBsum4v5e
PubMed18988853
UniProtQ5SLQ1|RL9_THET8 Large ribosomal subunit protein bL9 (Gene Name=rplI)

[Back to BioLiP]