Structure of PDB 8c3a Chain DH

Receptor sequence
>8c3aDH (length=97) Species: 5476 (Candida albicans) [Search protein sequence]
IRITLTSTKVKQLENVSANIIRNAAQYNIVKKGPVRMPTKVLKITTRKTP
NGEGSKTWDAYEMRIHKRVIDLQAPASTVKRITQITIEPGVDVEVTI
3D structure
PDB8c3a New crystal system to promote screening for new eukaryotic inhibitors
ChainDH
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna DH R22 E34 K52 G53 V55 R56 M57 P58 T59 K60 T65 T66 R67 K68 P70 N71 G72 E73 S75 K76 T77 W78 R84 H86 K87 R88 R2 E14 K32 G33 V35 R36 M37 P38 T39 K40 T45 T46 R47 K48 P50 N51 G52 E53 S55 K56 T57 W58 R64 H66 K67 R68
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8c3a, PDBe:8c3a, PDBj:8c3a
PDBsum8c3a
PubMed
UniProtA0A8H6BYJ9

[Back to BioLiP]