Structure of PDB 6hhq Chain DH

Receptor sequence

>6hhqDH (length=106) Species: 4932 (Saccharomyces cerevisiae)

AESHRLYVKGKHLSYQRSKRVNNPNVSLIKIEGVATPQDAQFYLGKRIAY
VYRASKEVRGSKIRVMWGKVTRTHGNSGVVRATFRNNLPAKTFGASVRIF
LYPSNI

3D structure

• PDB: 6hhq Understanding the role of intermolecular interactions between lissoclimides and the eukaryotic ribosome.
• Chain: DH
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	DH	A2 E3 H5 R6 Q17 R18 S19 K20 R21 V22 N23 P25 Q42 L45 G46 Y51 Y53 R54 S56 K57 S62 I64 R65 V66 W68 K70 T72 R73 H75 G76 N77 S78 R82 R86 N88 P90 A91 K92 T93 F94 A96 S97 R99	A1 E2 H4 R5 Q16 R17 S18 K19 R20 V21 N22 P24 Q41 L44 G45 Y50 Y52 R53 S55 K56 S61 I63 R64 V65 W67 K69 T71 R72 H74 G75 N76 S77 R81 R85 N87 P89 A90 K91 T92 F93 A95 S96 R98
BS02	OHX	DH	F85 R86	F84 R85
BS03	MG	DH	H75 S78 G79 V80	H74 S77 G78 V79

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000027 ribosomal large subunit assembly
• GO:0002181 cytoplasmic translation
• GO:0006364 rRNA processing
• GO:0006412 translation
• GO:0042273 ribosomal large subunit biogenesis

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6hhq, PDBe:6hhq, PDBj:6hhq
• PDBsum: 6hhq
• PubMed: 30759226
• UniProt: P05744|RL33A_YEAST Large ribosomal subunit protein eL33A (Gene Name=RPL33A)