Structure of PDB 4w2f Chain DH

Receptor sequence
>4w2fDH (length=174) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
SRIGRLPIPVPKGVSVEVAPGRVKVKGPKGELEVPVSPEMRVVVEEGVVR
VERPSDERRHKSLHGLTRTLIANAVKGVSEGYSKELLIKGIGYRARLVGR
ALELTVGFSHPVVVEPPEGITFEVPEPTRVRVSGIDKQKVGQVAANIRAI
RKPSAYHEKGIYYAGEPVRLKPGK
3D structure
PDB4w2f Amicoumacin a inhibits translation by stabilizing mRNA interaction with the ribosome.
ChainDH
Resolution2.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna DH S2 R3 I4 R59 K62 S63 G66 L67 T70 G108 F109 S110 H111 K138 Q139 G142 Q143 R152 Y157 H158 K160 K172 K175 S1 R2 I3 R58 K61 S62 G65 L66 T69 G107 F108 S109 H110 K137 Q138 G141 Q142 R151 Y156 H157 K159 K171 K174
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Thu Nov 28 19:53:33 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4w2f', asym_id = 'DH', title = 'Amicoumacin a inhibits translation by stabilizing mRNA interaction with the ribosome.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4w2f', asym_id='DH', title='Amicoumacin a inhibits translation by stabilizing mRNA interaction with the ribosome.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003735,0005840,0006412,0019843', uniprot = '', pdbid = '4w2f', asym_id = 'DH'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412,0019843', uniprot='', pdbid='4w2f', asym_id='DH')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>