Structure of PDB 4v97 Chain DH

Receptor sequence
>4v97DH (length=168) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
IGRLPIPVPKGVSVEVAPGRVKVKGPKGELEVPVSPEMRVVVEEGVVRVE
RPSDERRHKSLHGLTRTLIANAVKGVSEGYSKELLIKGIGYRARLVGRAL
ELTVGFSHPVVVEPPEGITFEVPEPTRVRVSGIDKQKVGQVAANIRAIRK
PSAYHEKGIYYAGEPVRL
3D structure
PDB4v97 Reorganization of an intersubunit bridge induced by disparate 16S ribosomal ambiguity mutations mimics an EF-Tu-bound state.
ChainDH
Resolution3.516 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna DH I4 R59 K62 S63 G66 L67 T70 F109 S110 K138 Q139 G142 Q143 R152 Y157 I1 R56 K59 S60 G63 L64 T67 F106 S107 K135 Q136 G139 Q140 R149 Y154
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Fri Nov 29 11:49:20 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4v97', asym_id = 'DH', title = 'Reorganization of an intersubunit bridge induced... ambiguity mutations mimics an EF-Tu-bound state.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4v97', asym_id='DH', title='Reorganization of an intersubunit bridge induced... ambiguity mutations mimics an EF-Tu-bound state.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003735,0005840,0006412,0019843', uniprot = '', pdbid = '4v97', asym_id = 'DH'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412,0019843', uniprot='', pdbid='4v97', asym_id='DH')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>