Structure of PDB 4v6g Chain DH

Receptor sequence

>4v6gDH (length=170) Species: 300852 (Thermus thermophilus HB8)

SRIGRLPIPVPKGVSVEVAPGRVKVKGPKGELEVPVSPEMRVVVEEGVVR
VERPSDERRHKSLHGLTRTLIANAVKGVSEGYSKELLIKGIGYRARLVGR
ALELTVGFSHPVVVEPPEGITFEVPEPTRVRVSGIDKQKVGQVAANIRAI
RKPSAYHEKGIYYAGEPVRL

3D structure

• PDB: 4v6g Structural aspects of messenger RNA reading frame maintenance by the ribosome.
• Chain: DH
• Resolution: 3.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	DH	S2 R3 I4 R59 K62 S63 G66 L67 T70 F109 S110 H111 K138 Q139 G142 Q143 A146 R152 Y157 K160 R170	S1 R2 I3 R58 K61 S62 G65 L66 T69 F108 S109 H110 K137 Q138 G141 Q142 A145 R151 Y156 K159 R169
BS02	MG	DH	N74 K77 Y83 K138	N73 K76 Y82 K137
BS03	MG	DH	K153 P154 S155 A156	K152 P153 S154 A155

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v6g, PDBe:4v6g, PDBj:4v6g
• PDBsum: 4v6g
• PubMed: 20400952
• UniProt: P0DOY8|RL6_THET8 Large ribosomal subunit protein uL6 (Gene Name=rplF)