Structure of PDB 4v6a Chain DH

Receptor sequence

>4v6aDH (length=159) Species: 300852 (Thermus thermophilus HB8)

PKGVSVEVAPGRVKVKGPKGELEVPVSPEMRVVVEEGVVRVERPSDERRH
KSLHGLTRTLIANAVKGVSEGYSKELLIKGIGYRARLVGRALELTVGFSH
PVVVEPPEGITFEVPEPTRVRVSGIDKQKVGQVAANIRAIRKPSAYHEKG
IYYAGEPVR

3D structure

• PDB: 4v6a Formation of the first peptide bond: the structure of EF-P bound to the 70S ribosome.
• Chain: DH
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	DH	R59 K62 S63 G66 L67 G108 F109 S110 H111 K138 Q139 G142 Q143 R152 K160	R48 K51 S52 G55 L56 G97 F98 S99 H100 K127 Q128 G131 Q132 R141 K149

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Tue Dec 3 21:54:20 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4v6a', asym_id = 'DH', title = 'Formation of the first peptide bond: the structure of EF-P bound to the 70S ribosome.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4v6a', asym_id='DH', title='Formation of the first peptide bond: the structure of EF-P bound to the 70S ribosome.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005840,0006412,0019843', uniprot = '', pdbid = '4v6a', asym_id = 'DH'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412,0019843', uniprot='', pdbid='4v6a', asym_id='DH')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>