Structure of PDB 4w29 Chain DG

Receptor sequence

>4w29DG (length=181) Species: 274 (Thermus thermophilus)

PLDVALKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLGEAKEDAR
ILEKAAQELALITGQKPAVTRAKKSISNFKLRKGMPIGLRVTLRRDRMWI
FLEKLLNVALPRIRDFRGLNPNSFDGRGNYNLGLREQLIFPEITYDMVDA
LRGMDIAVVTTAETDEEARALLELLGFPFRK

3D structure

• PDB: 4w29 How the ribosome hands the A-site tRNA to the P site during EF-G-catalyzed translocation.
• Chain: DG
• Resolution: 3.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	DG	K36 N40 Q41 G42 L43 G44 K47 T71 R72 A73 K74 I77 N79 G89 R91 S124 F125 D126 R128 N132 L133 G134 L135 R153 G154 M155 D156 V160	K35 N39 Q40 G41 L42 G43 K46 T70 R71 A72 K73 I76 N78 G88 R90 S123 F124 D125 R127 N131 L132 G133 L134 R152 G153 M154 D155 V159
BS02	rna	DG	N27 W29 E30 K67 A69 V70 R72 V92 T93	N26 W28 E29 K66 A68 V69 R71 V91 T92

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4w29, PDBe:4w29, PDBj:4w29
• PDBsum: 4w29
• PubMed: 25190797
• UniProt: P41201|RL5_THETH Large ribosomal subunit protein uL5 (Gene Name=rplE)