Structure of PDB 4v9n Chain DG

Receptor sequence

>4v9nDG (length=181) Species: 262724 (Thermus thermophilus HB27)

PLDLALKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLGEAKEDAR
ILEKAAQELALITGQKPAVTRAKKSISNFKLRKGMPIGLRVTLRRDRMWI
FLEKLLNVALPRIRDFRGLNPNSFDGRGNYNLGLREQLIFPEITYDMVDA
LRGMDIAVVTTAETDEEARALLELLGFPFRK

3D structure

• PDB: 4v9n Crystal Structure of the 70S Ribosome Bound with the Q253P Mutant Form of Release Factor RF2.
• Chain: DG
• Resolution: 3.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	DG	S76 I77 S78 R83	S75 I76 S77 R82
BS02	rna	DG	K36 N40 G42 G44 E45 T71 A73 N79 L82 R91 S124 D126 N132 G134 L135 R136 G154 M155 D156	K35 N39 G41 G43 E44 T70 A72 N78 L81 R90 S123 D125 N131 G133 L134 R135 G153 M154 D155
BS03	rna	DG	L3 N27 W29 E30 Q66 K67 A69 V70 R91 V92 T93 R95 R96 R98	L2 N26 W28 E29 Q65 K66 A68 V69 R90 V91 T92 R94 R95 R97

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v9n, PDBe:4v9n, PDBj:4v9n
• PDBsum: 4v9n
• PubMed: 23769667
• UniProt: Q72I16|RL5_THET2 Large ribosomal subunit protein uL5 (Gene Name=rplE)