Structure of PDB 4v95 Chain DG

Receptor sequence

>4v95DG (length=180) Species: 300852 (Thermus thermophilus HB8)

LDVALKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLGEAKEDARI
LEKAAQELALITGQKPAVTRAKKSISNFKLRKGMPIGLRVTLRRDRMWIF
LEKLLNVALPRIRDFRGLNPNSFDGRGNYNLGLREQLIFPEITYDMVDAL
RGMDIAVVTTAETDEEARALLELLGFPFRK

3D structure

• PDB: 4v95 Structural basis for the rescue of stalled ribosomes: structure of YaeJ bound to the ribosome.
• Chain: DG
• Resolution: 3.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	DG	S76 I77 S78	S74 I75 S76
BS02	rna	DG	K36 N40 G42 L43 T71 R72 K74 F80 I88 S124 D126 R128 N132 R136 G154 M155 D156 A158	K34 N38 G40 L41 T69 R70 K72 F78 I86 S122 D124 R126 N130 R134 G152 M153 D154 A156
BS03	rna	DG	N27 V28 W29 E30 Q66 K67 A69 V70 R72 R91 V92 T93 R95 R96 R98	N25 V26 W27 E28 Q64 K65 A67 V68 R70 R89 V90 T91 R93 R94 R96

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v95, PDBe:4v95, PDBj:4v95
• PDBsum: 4v95
• PubMed: 22422986
• UniProt: Q5SHQ0|RL5_THET8 Large ribosomal subunit protein uL5 (Gene Name=rplE)