Structure of PDB 8oeq Chain DF

Receptor sequence

>8oeqDF (length=142) Species: 5476 (Candida albicans)

LVVQEQGSFQHILRLLNTNIDGRIKIMYALTKIRGVGRRYANLVCKKADV
ELTKRAGELTQEELERIVTIMQNPTNYKIPAWFLNRQKDQVDGKDYHVLA
NNLESKLRDDLERLKKIRSHRGIRHFWGLKVRGQHTKTTSRG

3D structure

• PDB: 8oeq Drug-induced rotational movement of the ribosome is a key factor for read-through enhancement
• Chain: DF
• Resolution: 3.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	DF	Y30 R36 G37 V38 G39 R40 R41 Y42 R57 W84 F85 N87 Q89 K90 L109 D112 H122 R123 R126 H127 K132 V133 R134 G135 Q136 H137 T138 K139 T140 T141 S142 R143	Y28 R34 G35 V36 G37 R38 R39 Y40 R55 W82 F83 N85 Q87 K88 L107 D110 H120 R121 R124 H125 K130 V131 R132 G133 Q134 H135 T136 K137 T138 T139 S140 R141

External links

• PDB: RCSB:8oeq, PDBe:8oeq, PDBj:8oeq
• PDBsum: 8oeq
• UniProt: A0A8H6F3Y8