Structure of PDB 4v9m Chain DF

Receptor sequence

>4v9mDF (length=208) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]

MKEVAVYQIPVLSPSGRRELAADLPAEINPHLLWEVVRWQLAKRRRGTAS
TKTRGEVAYSGRKIWPQKHTGRARHGDIGAPIFVGGGVVFGPKPRDYSYT
LPKKVRKKGLAMAVADRAREGKLLLVEAFAGVNGKTKEFLAWAKEAGLDG
SESVLLVTGNELVRRAARNLPWVVTLAPEGLNVYDIVRTERLVMDLDAWE
VFQNRIGG

3D structure

PDB

4v9m Crystal structures of EF-G-ribosome complexes trapped in intermediate states of translocation.

Chain

Resolution

4.0 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	DF	N29 H31 W34 R38 L41 K43 R44 R45 R46 T48 S50 T51 K52 T53 R54 Y59 S60 R62 Q67 K68 H69 R72 A73 R74 H75 I82 F83 V84 G85 F90 R95 Y99 T100 L101 P102 K104 R106 K107 K108 G134 K135 T136 K137 R165 R168 N169 P171 E179 G180 Y184 R205	N29 H31 W34 R38 L41 K43 R44 R45 R46 T48 S50 T51 K52 T53 R54 Y59 S60 R62 Q67 K68 H69 R72 A73 R74 H75 I82 F83 V84 G85 F90 R95 Y99 T100 L101 P102 K104 R106 K107 K108 G134 K135 T136 K137 R165 R168 N169 P171 E179 G180 Y184 R205

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4v9m, PDBe:4v9m, PDBj:4v9m
PDBsum	4v9m
PubMed	23812722
UniProt	Q72I05\|RL4_THET2 Large ribosomal subunit protein uL4 (Gene Name=rplD)

[Back to BioLiP]