Structure of PDB 4v51 Chain DF

Receptor sequence

>4v51DF (length=207) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

MKEVAVYQIPVLSPSGRRELAADLPAEINPHLLWEVVRWQLAKRRRGTAS
TKTRGEVAYSGRKIWPQKHTGRARHGDIGAPIFVGGGVVFGPKPRDYSYT
LPKKVRKKGLAMAVADRAREGKLLLVEAFAGVNGKTKEFLAWAKEAGLDG
SESVLLVTGNELVRRAARNLPWVVTLAPEGLNVYDIVRTERLVMDLDAWE
VFQNRIG

3D structure

PDB

4v51 Structure of the 70S ribosome complexed with mRNA and tRNA.

Chain

Resolution

2.8 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	DF	H31 L32 E35 R38 Q40 L41 K43 R44 R45 R46 T48 S50 T51 K52 T53 R54 G55 V57 A58 Y59 S60 G61 K63 Q67 K68 H69 G71 R72 A73 R74 H75 G76 I82 F83 V84 V88 F90 P92 R95 Y99 T100 P102 K103 K104 V105 R106 K107 G134 K135 T136 K137 R165 R168 N169 P171 E179 G180 N182 Y184 R205	H31 L32 E35 R38 Q40 L41 K43 R44 R45 R46 T48 S50 T51 K52 T53 R54 G55 V57 A58 Y59 S60 G61 K63 Q67 K68 H69 G71 R72 A73 R74 H75 G76 I82 F83 V84 V88 F90 P92 R95 Y99 T100 P102 K103 K104 V105 R106 K107 G134 K135 T136 K137 R165 R168 N169 P171 E179 G180 N182 Y184 R205
BS02	MG	DF	R168 L170 V173	R168 L170 V173

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4v51, PDBe:4v51, PDBj:4v51
PDBsum	4v51
PubMed	16959973
UniProt	Q5SHN9\|RL4_THET8 Large ribosomal subunit protein uL4 (Gene Name=rplD)

[Back to BioLiP]