Structure of PDB 6zqg Chain DE

Receptor sequence

>6zqgDE (length=260) Species: 559292 (Saccharomyces cerevisiae S288C)

ARGPKKHLKRLAAPHHWLLDKLSGCYAPRPSAGPHKLRESLPLIVFLRNR
LKYALNGREVKAILMQRHVKVDGKVRTDTTYPAGFMDVITLDATNENFRL
VYDVKGRFAVHRITDEEASYKLGKVKKVQLGKKGVPYVVTHDGRTIRYPD
PNIKVNDTVKIDLASGKITDFIKFDAGKLVYVTGGRNLGRIGTIVHKERH
DGGFDLVHIKDSLDNTFVTRLNNVFVIGEQGKPYISLPKGKGIKLSIAEE
RDRRRAQQGL

3D structure

• PDB: 6zqg 90 S pre-ribosome transformation into the primordial 40 S subunit.
• Chain: DE
• Resolution: 3.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	DE	A2 R3 K7 H8 K10 L12 L19 D21 K22 Y27 P29 R30 A33 G34 K37 R49 G58 K75 R77 K106 R108 L131 G132 K133 K134 V140 T146 R148 R187 H201 D202 R255	A1 R2 K6 H7 K9 L11 L18 D20 K21 Y26 P28 R29 A32 G33 K36 R48 G57 K74 R76 K105 R107 L130 G131 K132 K133 V139 T145 R147 R186 H200 D201 R254

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:0030686 90S preribosome
• GO:0032991 protein-containing complex
• GO:0043232 intracellular non-membrane-bounded organelle
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6zqg, PDBe:6zqg, PDBj:6zqg
• PDBsum: 6zqg
• PubMed: 32943521
• UniProt: P0CX35|RS4A_YEAST Small ribosomal subunit protein eS4A (Gene Name=RPS4A)