Structure of PDB 6hhq Chain DE

Receptor sequence

>6hhqDE (length=97) Species: 4932 (Saccharomyces cerevisiae)

SINQKLALVIKSGKYTLGYKSTVKSLRQGKSKLIIIAANTPVLRKSELEY
YAMLSKTKVYYFQGGNNELGTAVGKLFRVGVVSILEAGDSDILTTLA

3D structure

• PDB: 6hhq Understanding the role of intermolecular interactions between lissoclimides and the eukaryotic ribosome.
• Chain: DE
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	DE	L25 G26 K28 S29 P49 V50 R52 S54 L84 F85 R86 V87 G88	L17 G18 K20 S21 P41 V42 R44 S46 L76 F77 R78 V79 G80
BS02	MG	DE	K83 L84	K75 L76

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0030627 pre-mRNA 5'-splice site binding

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006364 rRNA processing
• GO:0048025 negative regulation of mRNA splicing, via spliceosome

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6hhq, PDBe:6hhq, PDBj:6hhq
• PDBsum: 6hhq
• PubMed: 30759226
• UniProt: P14120|RL30_YEAST Large ribosomal subunit protein eL30 (Gene Name=RPL30)