Structure of PDB 4wt8 Chain DE

Receptor sequence

>4wt8DE (length=181) Species: 300852 (Thermus thermophilus HB8)

PLDVALKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLGEAKEDAR
ILEKAAQELALITGQKPAVTRAKKSISNFKLRKGMPIGLRVTLRRDRMWI
FLEKLLNVALPRIRDFRGLNPNSFDGRGNYNLGLREQLIFPEITYDMVDA
LRGMDIAVVTTAETDEEARALLELLGFPFRK

3D structure

• PDB: 4wt8 Bactobolin A Binds to a Site on the 70S Ribosome Distinct from Previously Seen Antibiotics.
• Chain: DE
• Resolution: 3.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	DE	S78 R83	S77 R82
BS02	rna	DE	N27 W29 E30 Q66 K67 A69 V70 V92 T93 R95 R96 R98	N26 W28 E29 Q65 K66 A68 V69 V91 T92 R94 R95 R97
BS03	rna	DE	K36 V38 N40 G44 T71 A73 K75 N79 G89 R91 S124 D126 R128 N132 L135 R136 G154 D156 V160	K35 V37 N39 G43 T70 A72 K74 N78 G88 R90 S123 D125 R127 N131 L134 R135 G153 D155 V159

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4wt8, PDBe:4wt8, PDBj:4wt8
• PDBsum: 4wt8
• PubMed: 25562208
• UniProt: Q5SHQ0|RL5_THET8 Large ribosomal subunit protein uL5 (Gene Name=rplE)