Structure of PDB 4v83 Chain DE

Receptor sequence

>4v83DE (length=202) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]

MYQIPVLSPSGRRELAADLPAEINPHLLWEVVRWQLAKRRRGTASTKTRG
EVAYSGRKIWPQKHTGRARHGDIGAPIFVGGGVVFGPKPRDYSYTLPKKV
RKKGLAMAVADRAREGKLLLVEAFAGVNGKTKEFLAWAKEAGLDGSESVL
LVTGNELVRRAARNLPWVVTLAPEGLNVYDIVRTERLVMDLDAWEVFQNR
IG

3D structure

PDB

4v83 Crystal structures of complexes containing domains from two viral internal ribosome entry site (IRES) RNAs bound to the 70S ribosome.

Chain

Resolution

3.5 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	DE	H31 W34 E35 R38 Q40 L41 R44 R45 R46 T48 A49 S50 T51 K52 T53 R54 V57 A58 Y59 S60 R62 K63 Q67 H69 G71 R72 A73 R74 H75 P81 I82 F83 V84 G85 V89 F90 P92 R95 Y99 T100 P102 K103 K104 R106 G134 K135 T136 K137 R165 R168 N169 L170 P171 L176 G180 N182 Y184 R205	H26 W29 E30 R33 Q35 L36 R39 R40 R41 T43 A44 S45 T46 K47 T48 R49 V52 A53 Y54 S55 R57 K58 Q62 H64 G66 R67 A68 R69 H70 P76 I77 F78 V79 G80 V84 F85 P87 R90 Y94 T95 P97 K98 K99 R101 G129 K130 T131 K132 R160 R163 N164 L165 P166 L171 G175 N177 Y179 R200

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4v83, PDBe:4v83, PDBj:4v83
PDBsum	4v83
PubMed	21245352
UniProt	Q72I05\|RL4_THET2 Large ribosomal subunit protein uL4 (Gene Name=rplD)

[Back to BioLiP]