Structure of PDB 4v5b Chain DE

Receptor sequence
>4v5bDE (length=150) Species: 83334 (Escherichia coli O157:H7) [Search protein sequence]
ELQEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGRVGFGYGKAREVPAA
IQKAMEKARRNMINVALNNGTLQHPVKGVHTGSRVFMQPASEGTGIIAGG
AMRAVLEVAGVHNVLAKAYGSTNPINVVRATIDGLENMNSPEMVAAKRGK
3D structure
PDB4v5b A Peptide Deformylase-Ribosome Complex Reveals Mechanism of Nascent Chain Processing.
ChainDE
Resolution3.74 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna DE V20 S21 K22 T23 V24 K25 Y49 K51 T89 F94 T102 A106 G107 L123 A124 K125 A126 Y127 S129 T130 N131 N134 R137 V12 S13 K14 T15 V16 K17 Y41 K43 T81 F86 T94 A98 G99 L115 A116 K117 A118 Y119 S121 T122 N123 N126 R129
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0046677 response to antibiotic
GO:1990145 maintenance of translational fidelity
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v5b, PDBe:4v5b, PDBj:4v5b
PDBsum4v5b
PubMed18288106
UniProtP0A7W3|RS5_ECO57 Small ribosomal subunit protein uS5 (Gene Name=rpsE)

[Back to BioLiP]