Structure of PDB 6zyt Chain DDD

Receptor sequence
>6zytDDD (length=112) Species: 1895 (Streptomyces avidinii) [Search protein sequence]
AGITGTWYNQSGSTFTVTAGADGNLTGQYENRAQGTGCQNSPYTLTGRYN
GTKLEWRVEWNNSTENCHSRTEWRGQYQGGAEARINTQWNLTYEGGSGPA
TEQGQDTFTKVK
3D structure
PDB6zyt The role of streptavidin and its variants in catalysis by biotinylated secondary amines.
ChainDDD
Resolution1.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 UJE DDD N34 S38 Y54 N56 G62 W85 S94 T96 W114 Y118 N9 S13 Y29 N31 G37 W60 S69 T71 W89 Y93
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sat Apr 19 16:07:58 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6zyt', asym_id = 'DDD', title = 'The role of streptavidin and its variants in catalysis by biotinylated secondary amines.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6zyt', asym_id='DDD', title='The role of streptavidin and its variants in catalysis by biotinylated secondary amines.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0009374', uniprot = '', pdbid = '6zyt', asym_id = 'DDD'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0009374', uniprot='', pdbid='6zyt', asym_id='DDD')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>