Structure of PDB 6t94 Chain DDD

Receptor sequence

>6t94DDD (length=367) Species: 209285 (Thermochaetoides thermophila)

TARLQMVKVLAVLYDGGEHAKQVPGLLGTTENELGLRKWLEDQGHTLVTT
SDKDREGSTFDRELEDAEIIITTPFHPGYLTAERLARAKKLKLAVTAGIG
SDHVDLDAANKTNGGITVAEVTGSCVVSVAEHVVMTILVLVRNFVPAHEQ
IEAGRWDVAEVAKDEYDLEGKVVGTVGVGRIGERVLRRLKGFDCKELLYY
DYQPLSPEKEKEIGCRRVENLEEMLAQCDVVTINCPLHESTRGLFNKDLI
SKMKRGSWLVNTARGAIVVKEDVAEALRTGHLRGYGGDVWFPQPAPADHV
LRTAKNPFGGGNAMVPHMSGTSLDAQKRYAEGVKRILDSYLSGRFDYRPE
DLIVHQGKYATRAYGQR

3D structure

• PDB: 6t94 Structural insights into the NAD + -dependent formate dehydrogenase mechanism revealed from the NADH complex and the formate NAD + ternary complex of the Chaetomium thermophilum enzyme.
• Chain: DDD
• Resolution: 1.15 Å

Enzymatic activity

• Enzyme Commision number: 1.17.1.9: formate dehydrogenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NAI	DDD	I94 V124 G172 G174 R175 I176 Y195 D196 Y197 Q198 C230 P231 H233 T257 A258 R259 D283 H312 S314 G315 A358	I99 V129 G177 G179 R180 I181 Y200 D201 Y202 Q203 C235 P236 H238 T262 A263 R264 D288 H317 S319 G320 A363

Gene Ontology

Molecular Function

• GO:0008863 formate dehydrogenase (NAD+) activity
• GO:0016491 oxidoreductase activity
• GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
• GO:0051287 NAD binding

Biological Process

• GO:0042183 formate catabolic process

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:6t94, PDBe:6t94, PDBj:6t94
• PDBsum: 6t94
• PubMed: 33148525
• UniProt: G0SGU4|FDH_CHATD Formate dehydrogenase (Gene Name=FDH)