Structure of PDB 6woo Chain DD

Receptor sequence
>6wooDD (length=223) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
ALISKKRKLVADGVFYAELNEFFTRELAEEGYSGVEVRVTPTKTEVIIRA
TRTQDVLGENGRRINELTLLVQKRFKYAPGTIVLYAERVQDRGLSAVAQA
ESMKFKLLNGLAIRRAAYGVVRYVMESGAKGCEVVVSGKLRAARAKAMKF
ADGFLIHSGQPVNDFIDTATRHVLMRQGVLGIKVKIMRDPAKSRTGPKAL
PDAVTIIEPKEEEPILAPSVKDY
3D structure
PDB6woo An active role of the eukaryotic large ribosomal subunit in translation initiation fidelity.
ChainDD
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna DD L4 I5 S6 K8 R9 G140 K141 A145 R146 A147 K151 F156 L157 I158 H159 S160 G161 Q162 P163 H174 Q179 V181 G183 P203 D204 L2 I3 S4 K6 R7 G138 K139 A143 R144 A145 K149 F154 L155 I156 H157 S158 G159 Q160 P161 H172 Q177 V179 G181 P201 D202
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0003906 DNA-(apurinic or apyrimidinic site) endonuclease activity
GO:0005515 protein binding
Biological Process
GO:0000054 ribosomal subunit export from nucleus
GO:0000056 ribosomal small subunit export from nucleus
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0070651 nonfunctional rRNA decay
GO:1990145 maintenance of translational fidelity
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022626 cytosolic ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:0030686 90S preribosome
GO:0030688 preribosome, small subunit precursor
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6woo, PDBe:6woo, PDBj:6woo
PDBsum6woo
PubMed
UniProtP05750|RS3_YEAST Small ribosomal subunit protein uS3 (Gene Name=RPS3)

[Back to BioLiP]