Structure of PDB 6boh Chain DD

Receptor sequence

>6bohDD (length=88) Species: 262724 (Thermus thermophilus HB27)

PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHH
SHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG

3D structure

• PDB: 6boh Conformational Control of Translation Termination on the 70S Ribosome.
• Chain: DD
• Resolution: 3.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	DD	P2 K5 K8 Q9 D21 T22 G23 T25 Q28 L31 R35 R38 L39 H42 H46 K48 D49 H50 H51 S52 H53 R54 L57 M58 Q62 R65 Y69 R72	P1 K4 K7 Q8 D20 T21 G22 T24 Q27 L30 R34 R37 L38 H41 H45 K47 D48 H49 H50 S51 H52 R53 L56 M57 Q61 R64 Y68 R71
BS02	rna	DD	H53 L56 V60 G89	H52 L55 V59 G88
BS03	MG	DD	P2 I3	P1 I2

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6boh, PDBe:6boh, PDBj:6boh
• PDBsum: 6boh
• PubMed: 29731232
• UniProt: P62657|RS15_THET2 Small ribosomal subunit protein uS15 (Gene Name=rpsO)