Structure of PDB 4v8u Chain DC

Receptor sequence
>4v8uDC (length=228) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
PKHGKRYRALLEKVDPNKVYTIDEAARLVKELATAKFDETVEVHAKLGID
PRRSDQNVRGTVSLPHGLGKQVRVLAIAKGEKIKEAEEAGADYVGGEEII
QKILDGWMDFDAVVATPDVMGAVGSKLGRILGPRGLLPNPKAGTVGFNIG
EIIREIKAGRIEFRNDKTGAIHAPVGKASFPPEKLADNIRAFIRALEAHK
PEGAKGTFLRSVYVTTTMGPSVRINPHS
3D structure
PDB4v8u Crystal structure of 70S ribosome with both cognate tRNAs in the E and P sites representing an authentic elongation complex.
ChainDC
Resolution3.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna DC R53 S55 G133 R165 R52 S54 G132 R164
BS02 rna DC H4 K6 R7 Y8 K37 F38 T41 E43 H45 K47 R130 P134 R135 D167 K168 T169 H173 P175 S212 Y214 T218 M219 S222 H3 K5 R6 Y7 K36 F37 T40 E42 H44 K46 R129 P133 R134 D166 K167 T168 H172 P174 S211 Y213 T217 M218 S221
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
GO:0006417 regulation of translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v8u, PDBe:4v8u, PDBj:4v8u
PDBsum4v8u
PubMed23527033
UniProtQ5SLP7|RL1_THET8 Large ribosomal subunit protein uL1 (Gene Name=rplA)

[Back to BioLiP]