Structure of PDB 4v5k Chain DC

Receptor sequence
>4v5kDC (length=190) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
KVYTIDEAARTAKFDETVEVHAKLGIDPRRSDQNVRGTVSLPHGLGKQVR
VLAIAKGEKIKEAEEAGADYVGGEEIIQKILDGWMDFVMGAVGSKLGRIL
GPRGLNPKAGTVGFNIGEIIREIKAGRIEFRNDKTGAIHAPVGKASFPPE
KLADNIRAFIRALEAHKPEGAKGTFLRSVYVTTTMGPSVR
3D structure
PDB4v5k Structural Basis for 16S Ribosomal RNA Cleavage by the Cytotoxic Domain of Colicin E3.
ChainDC
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna DC R52 R53 R29 R30
BS02 rna DC T34 A35 K36 T40 E42 H44 K46 K70 D166 T168 I171 K205 S211 V212 Y213 V214 T215 T216 T217 M218 P220 T11 A12 K13 T17 E19 H21 K23 K47 D133 T135 I138 K172 S178 V179 Y180 V181 T182 T183 T184 M185 P187
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
GO:0006417 regulation of translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v5k, PDBe:4v5k, PDBj:4v5k
PDBsum4v5k
PubMed20852642
UniProtQ5SLP7|RL1_THET8 Large ribosomal subunit protein uL1 (Gene Name=rplA)

[Back to BioLiP]