Structure of PDB 8c3a Chain DB

Receptor sequence

>8c3aDB (length=127) Species: 5476 (Candida albicans) [Search protein sequence]

SQVFGVARIFASFNDTFVHVTDLSGKETIARVTGGMKVKADRDESSPYAA
MLAAQDVAAKCKEVGITAVHIKLRATGGTKTKTPGPGGQSALRALARSGL
RIGRIEDVTPVPSDSTRRKGGRRGRRL

3D structure

PDB

8c3a New crystal system to promote screening for new eukaryotic inhibitors

Chain

Resolution

3.0 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	DB	R13 N19 D20 F22 H24 S29 G30 K31 E32 T33 R36 T38 G40 M41 D46 R47 E49 R79 V116 P117 S118 D119 S120 T121 R122 K124 G126 R127 R128 R130 R131 L132	R8 N14 D15 F17 H19 S24 G25 K26 E27 T28 R31 T33 G35 M36 D41 R42 E44 R74 V111 P112 S113 D114 S115 T116 R117 K119 G121 R122 R123 R125 R126 L127
BS02	MG	DB	N19 E49	N14 E44

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links