Structure of PDB 6bok Chain DA

Receptor sequence
>6bokDA (length=53) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]
ASEVRIKLLLECTECKRRNYATEKNKRNTPNKLELRKYCPWCRKHTVHRE
VKI
3D structure
PDB6bok Conformational Control of Translation Termination on the 70S Ribosome.
ChainDA
Resolution3.55 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna DA A2 R6 K8 L10 R18 R19 Y21 E24 N26 N29 L34 L36 R37 K38 Y39 W42 R44 H46 A1 R5 K7 L9 R17 R18 Y20 E23 N25 N28 L33 L35 R36 K37 Y38 W41 R43 H45
BS02 ZN DA C13 C16 C12 C15
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6bok, PDBe:6bok, PDBj:6bok
PDBsum6bok
PubMed29731232
UniProtQ72GW3|RL33_THET2 Large ribosomal subunit protein bL33 (Gene Name=rpmG)

[Back to BioLiP]