Structure of PDB 7y7a Chain D9

Receptor sequence

>7y7aD9 (length=341) Species: 35688 (Porphyridium purpureum) [Search protein sequence]

RGWFDLIDDWLKRDRFVFIGWSGLLLLPCSYLALGGWLTGTTFVTSWYTH
GLASSYLEGCNFLTAAVSTPANSMGHSLLFLWGPEAQGDFTRWCQIGGLW
TFIALHGAFGLIGFCLRQFEIARLVGLRPYNAIAFSGPISVFVSVFLMYP
LGQASWFFAPSFGVAAIFRFLLFLQGFHNWTLNPFHMMGVAGILGGALLC
AIHGATVENTLFEDGDAADTFRAFTPTQSEETYSMVTANRFWSQIFGVAF
SNKRWLHFFMLFVPVTGLWTSSIGIVGLALNLRAYDFVSQELRAAEDPEF
ETFYTKNILLNEGIRAWMAAQDQPHENFIFPEEVLPRGNAL

3D structure

PDB

7y7a In situ structure of the red algal phycobilisome-PSII-PSI-LHC megacomplex.

Chain

Resolution

4.3 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

1.10.3.9: photosystem II.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	CLA	D9	L182 L205	L171 L194
BS02	CLA	D9	F73 F157 I178 F179 L182	F62 F146 I167 F168 L171
BS03	PHO	D9	L205 L209 I213 W253 F257	L194 L198 I202 W242 F246
BS04	BCT	D9	H214 H268	H203 H257
BS05	CLA	D9	M198 V201 A202	M187 V190 A191
BS06	CLA	D9	P149 V152 V156 F181 L182 Q186 W191 T192 H197 G200 V201 I204 L205 S282 I286	P138 V141 V145 F170 L171 Q175 W180 T181 H186 G189 V190 I193 L194 S271 I275
BS07	PHO	D9	L45 W48 G121 F125 Q129 N142 A145 F146 P149 F153 F173 G174 P275	L34 W37 G110 F114 Q118 N131 A134 F135 P138 F142 F162 G163 P264
BS08	CLA	D9	C40 L43 F91 L92 T112 F113 L116 H117	C29 L32 F80 L81 T101 F102 L105 H106
BS09	CLA	D9	F120 I123 C126 L127 F130	F109 I112 C115 L116 F119

Gene Ontology

	Molecular Function
GO:0005506	iron ion binding
GO:0009055	electron transfer activity
GO:0016168	chlorophyll binding
GO:0016491	oxidoreductase activity
GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872	metal ion binding

	Biological Process
GO:0009772	photosynthetic electron transport in photosystem II
GO:0015979	photosynthesis
GO:0019684	photosynthesis, light reaction

	Cellular Component
GO:0009507	chloroplast
GO:0009523	photosystem II
GO:0009535	chloroplast thylakoid membrane
GO:0009579	thylakoid
GO:0016020	membrane
GO:0042651	thylakoid membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7y7a, PDBe:7y7a, PDBj:7y7a
PDBsum	7y7a
PubMed	36922595
UniProt	W0RYZ0

[Back to BioLiP]