Structure of PDB 5fci Chain D9

Receptor sequence

>5fciD9 (length=53) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

ENVWFSHPRRYGKGSRQCRVCSSHTGLIRKYGLNICRQCFREKANDIGFN
KFR

3D structure

PDB

5fci ?

Chain

Resolution

3.4 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	D9	W7 F8 S9 H10 R12 R13 Y14 G15 K16 G17 R19 C24 G29 L30 I31 R32 K33 Y34 R40 Q41 R44 E45 K54 F55 R56	W4 F5 S6 H7 R9 R10 Y11 G12 K13 G14 R16 C21 G26 L27 I28 R29 K30 Y31 R37 Q38 R41 E42 K51 F52 R53
BS02	ZN	D9	C21 C39 C42	C18 C36 C39
BS03	OHX	D9	S25 H27	S22 H24
BS04	MG	D9	S9 R12	S6 R9
BS05	MG	D9	S26 T28	S23 T25

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0008270	zinc ion binding
GO:0046872	metal ion binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:5fci, PDBe:5fci, PDBj:5fci
PDBsum	5fci
PubMed	26906928
UniProt	P41057\|RS29A_YEAST Small ribosomal subunit protein uS14A (Gene Name=RPS29A)