Structure of PDB 4v9m Chain D9

Receptor sequence
>4v9mD9 (length=37) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]
MKVRASVKRICDKCKVIRRHGRVYVICENPKHKQRQG
3D structure
PDB4v9m Crystal structures of EF-G-ribosome complexes trapped in intermediate states of translocation.
ChainD9
Resolution4.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna D9 M1 K2 V3 R4 A5 S6 K8 R9 V16 R18 R19 V23 Y24 P30 K31 K33 R35 Q36 M1 K2 V3 R4 A5 S6 K8 R9 V16 R18 R19 V23 Y24 P30 K31 K33 R35 Q36
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v9m, PDBe:4v9m, PDBj:4v9m
PDBsum4v9m
PubMed23812722
UniProtQ72I28|RL36_THET2 Large ribosomal subunit protein bL36 (Gene Name=rpmJ)

[Back to BioLiP]