Structure of PDB 6gsk Chain D8

Receptor sequence
>6gskD8 (length=100) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
MFAIVKTGGKQYRVEPGLKLRVEKLDAEPGATVELPVLLLGGEKTVVGTP
VVEGASVVAEVLGHGRGKKILVSKFKAKVQYRRKKGHRQPYTELLIKEIR
3D structure
PDB6gsk Tautomeric G•U pairs within the molecular ribosomal grip and fidelity of decoding in bacteria.
ChainD8
Resolution3.36 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna D8 G8 G9 K10 K19 R21 E23 K24 K69 K74 F75 K76 K78 V79 Q80 Y81 R83 K84 K85 G86 H87 Q89 P90 E93 G8 G9 K10 K19 R21 E23 K24 K69 K74 F75 K76 K78 V79 Q80 Y81 R83 K84 K85 G86 H87 Q89 P90 E93
BS02 MG D8 F75 Q80 R82 F75 Q80 R82
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6gsk, PDBe:6gsk, PDBj:6gsk
PDBsum6gsk
PubMed29931292
UniProtP60492|RL21_THET8 Large ribosomal subunit protein bL21 (Gene Name=rplU)

[Back to BioLiP]