Structure of PDB 4w29 Chain D8

Receptor sequence
>4w29D8 (length=64) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]
PKMKTHKGAKKRVKITASGKVVAMKTGKRHLNWQKSGKEIRQKGRKFVLA
KPEAERIKLLLPYE
3D structure
PDB4w29 How the ribosome hands the A-site tRNA to the P site during EF-G-catalyzed translocation.
ChainD8
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna D8 P2 K3 M4 K5 T6 H7 K8 K11 R13 K15 T17 A18 S19 K26 K29 R30 H31 L32 N33 W34 Q35 S37 G38 K39 R42 Q43 R46 F48 K52 L62 P63 P1 K2 M3 K4 T5 H6 K7 K10 R12 K14 T16 A17 S18 K25 K28 R29 H30 L31 N32 W33 Q34 S36 G37 K38 R41 Q42 R45 F47 K51 L61 P62
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4w29, PDBe:4w29, PDBj:4w29
PDBsum4w29
PubMed25190797
UniProtQ72L77|RL35_THET2 Large ribosomal subunit protein bL35 (Gene Name=rpmI)

[Back to BioLiP]