Structure of PDB 4v9m Chain D8

Receptor sequence
>4v9mD8 (length=64) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]
PKMKTHKGAKKRVKITASGKVVAMKTGKRHLNWQKSGKEIRQKGRKFVLA
KPEAERIKLLLPYE
3D structure
PDB4v9m Crystal structures of EF-G-ribosome complexes trapped in intermediate states of translocation.
ChainD8
Resolution4.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna D8 P2 K3 M4 K5 T6 K8 K11 K12 R13 K15 T17 A18 S19 K21 K26 T27 G28 K29 R30 H31 L32 N33 W34 K39 E40 R42 K47 F48 K52 L61 L62 P1 K2 M3 K4 T5 K7 K10 K11 R12 K14 T16 A17 S18 K20 K25 T26 G27 K28 R29 H30 L31 N32 W33 K38 E39 R41 K46 F47 K51 L60 L61
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v9m, PDBe:4v9m, PDBj:4v9m
PDBsum4v9m
PubMed23812722
UniProtQ72L77|RL35_THET2 Large ribosomal subunit protein bL35 (Gene Name=rpmI)

[Back to BioLiP]