Structure of PDB 1vy7 Chain D8

Receptor sequence

>1vy7D8 (length=64) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

PKMKTHKGAKKRVKITASGKVVAMKTGKRHLNWQKSGKEIRQKGRKFVLA
KPEAERIKLLLPYE

3D structure

PDB

1vy7 A proton wire to couple aminoacyl-tRNA accommodation and peptide-bond formation on the ribosome.

Chain

Resolution

2.8 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	D8	P2 K3 M4 K5 T6 H7 K8 K12 R13 K15 T17 A18 S19 K21 K26 T27 G28 R30 H31 L32 N33 W34 Q35 K39 I41 R42 K44 R46 K47 L50 A51 K52 P53 E54 P63 Y64	P1 K2 M3 K4 T5 H6 K7 K11 R12 K14 T16 A17 S18 K20 K25 T26 G27 R29 H30 L31 N32 W33 Q34 K38 I40 R41 K43 R45 K46 L49 A50 K51 P52 E53 P62 Y63

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:1vy7, PDBe:1vy7, PDBj:1vy7
PDBsum	1vy7
PubMed	25132179
UniProt	Q5SKU1\|RL35_THET8 Large ribosomal subunit protein bL35 (Gene Name=rpmI)