Structure of PDB 7y5e Chain D6

Receptor sequence

>7y5eD6 (length=341) Species: 35688 (Porphyridium purpureum) [Search protein sequence]

RGWFDLIDDWLKRDRFVFIGWSGLLLLPCSYLALGGWLTGTTFVTSWYTH
GLASSYLEGCNFLTAAVSTPANSMGHSLLFLWGPEAQGDFTRWCQIGGLW
TFIALHGAFGLIGFCLRQFEIARLVGLRPYNAIAFSGPISVFVSVFLMYP
LGQASWFFAPSFGVAAIFRFLLFLQGFHNWTLNPFHMMGVAGILGGALLC
AIHGATVENTLFEDGDAADTFRAFTPTQSEETYSMVTANRFWSQIFGVAF
SNKRWLHFFMLFVPVTGLWTSSIGIVGLALNLRAYDFVSQELRAAEDPEF
ETFYTKNILLNEGIRAWMAAQDQPHENFIFPEEVLPRGNAL

3D structure

PDB

7y5e In situ structure of the red algal phycobilisome-PSII-PSI-LHC megacomplex.

Chain

Resolution

3.3 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

1.10.3.9: photosystem II.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	CLA	D6	V175 I178 F179 L182	V164 I167 F168 L171
BS02	PHO	D6	L205 L209 A212 I213 W253 F257	L194 L198 A201 I202 W242 F246
BS03	BCT	D6	H214 H268	H203 H257
BS04	CLA	D6	M198 V201 A202	M187 V190 A191
BS05	CLA	D6	V152 V156 F181 L182 L185 Q186 W191 T192 H197 G200 V201 I204 L279 S282	V141 V145 F170 L171 L174 Q175 W180 T181 H186 G189 V190 I193 L268 S271
BS06	PHO	D6	S41 L45 W48 G118 G121 F125 Q129 A145 F146 P149 F173 G174	S30 L34 W37 G107 G110 F114 Q118 A134 F135 P138 F162 G163
BS07	CLA	D6	P39 C40 F91 L92 W93 T112 F113 H117 F120	P28 C29 F80 L81 W82 T101 F102 H106 F109
BS08	CLA	D6	F120 I123 C126 L127 F130	F109 I112 C115 L116 F119

Gene Ontology

	Molecular Function
GO:0005506	iron ion binding
GO:0009055	electron transfer activity
GO:0016168	chlorophyll binding
GO:0016491	oxidoreductase activity
GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872	metal ion binding

	Biological Process
GO:0009772	photosynthetic electron transport in photosystem II
GO:0015979	photosynthesis
GO:0019684	photosynthesis, light reaction

	Cellular Component
GO:0009507	chloroplast
GO:0009523	photosystem II
GO:0009535	chloroplast thylakoid membrane
GO:0009579	thylakoid
GO:0016020	membrane
GO:0042651	thylakoid membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7y5e, PDBe:7y5e, PDBj:7y5e
PDBsum	7y5e
PubMed	36922595
UniProt	W0RYZ0

[Back to BioLiP]