Structure of PDB 7qep Chain D6

Receptor sequence
>7qepD6 (length=101) Species: 284813 (Encephalitozoon cuniculi GB-M1) [Search protein sequence]
MRRNHGRGKKNRGSAGSIQCDKCGSVTPKDKAIKRFRIQSLIEQASFDDL
KQATIYDVFEVPRMGYKSQFCVSCACHAKIVRVRSSQARKIRYGFNPNRV
A
3D structure
PDB7qep Adaptation to genome decay in the structure of the smallest eukaryotic ribosome
ChainD6
Resolution2.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna D6 M1 R2 R3 N4 H5 G6 N11 R12 G13 S14 K29 K31 R35 F36 K67 V72 C76 V81 R84 S85 R89 R92 Y93 G94 F95 R99 M1 R2 R3 N4 H5 G6 N11 R12 G13 S14 K29 K31 R35 F36 K67 V72 C76 V81 R84 S85 R89 R92 Y93 G94 F95 R99
BS02 ZN D6 C20 C23 C74 C20 C23 C74
Gene Ontology
Molecular Function
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7qep, PDBe:7qep, PDBj:7qep
PDBsum7qep
PubMed
UniProtQ8SRN2|RS26_ENCCU Small ribosomal subunit protein eS26 (Gene Name=RPS26)

[Back to BioLiP]