Structure of PDB 4v6a Chain D6

Receptor sequence
>4v6aD6 (length=48) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
RIKLLLECTECKRRNYATEKNKRNTPNKLELRKYCPWCRKHTVHREVK
3D structure
PDB4v6a Formation of the first peptide bond: the structure of EF-P bound to the 70S ribosome.
ChainD6
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna D6 R19 Y21 K25 P31 K38 W42 K45 H46 R14 Y16 K20 P26 K33 W37 K40 H41
BS02 MG D6 E15 P41 C43 E10 P36 C38
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v6a, PDBe:4v6a, PDBj:4v6a
PDBsum4v6a
PubMed19696344
UniProtP35871|RL33_THET8 Large ribosomal subunit protein bL33 (Gene Name=rpmG)

[Back to BioLiP]